General Information

  • ID:  hor005525
  • Uniprot ID:  Q6UWT2
  • Protein name:  Adropin
  • Gene name:  ENHO
  • Organism:  Homo sapiens (Human)
  • Family:  NA
  • Source:  Human
  • Expression:  Expressed in liver and brain.
  • Disease:  Diseases associated with ENHO include Apnea, Obstructive Sleep and Type 2 Diabetes Mellitus.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0045747 positive regulation of Notch signaling pathway
  • GO CC:  GO:0005576 extracellular region; GO:0005886 plasma membrane

Sequence Information

  • Sequence:  CHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQP
  • Length:  43
  • Propeptide:  MGAAISQGALIAIVCNGLVGFLLLLLWVILCWACHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQP
  • Signal peptide:  MGAAISQGALIAIVCNGLVGFLLLLLWVILCWA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Involved in the regulation of glucose homeostasis and lipid metabolism;a potential endothelial protective role
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q6UWT2-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005525_AF2.pdbhor005525_ESM.pdb

Physical Information

Mass: 525116 Formula: C190H295N55O68S2
Absent amino acids: FIMTW Common amino acids: S
pI: 5.49 Basic residues: 5
Polar residues: 16 Hydrophobic residues: 6
Hydrophobicity: -109.3 Boman Index: -9821
Half-Life: 1.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 38.6
Instability Index: 10866.98 Extinction Coefficient cystines: 1615
Absorbance 280nm: 38.45

Literature

  • PubMed ID:  20837912
  • Title:  Adropin is a novel regulator of endothelial function